Structure of chaetomium thermophilum skn7 coiled-coil domain, crystal form i
PDB DOI: 10.2210/pdb5d5y/pdb
Classification: TRANSCRIPTION Organism(s): Chaetomium Thermophilum
Deposited: 2015-08-11 Deposition Author(s): Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Neudegger, T. , Verghese, J.
Structure of chaetomium thermophilum skn7 coiled-coil domain, crystal form i
Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Neudegger, T. , Verghese, J.
Primary Citation of Related Structures: 5D5Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative transcription factor | B | 50 | Chaetomium Thermophilum | SQQQIAALSESLQATQQQLQALQQQCYELEKTNRLLVSEVMTLQKMVKAQ |
| Putative transcription factor | A | 50 | Chaetomium Thermophilum | SQQQIAALSESLQATQQQLQALQQQCYELEKTNRLLVSEVMTLQKMVKAQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-08-11 Deposition Author(s): Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Neudegger, T. , Verghese, J.