Crystal structure of the catalytic domain of human mmp12 in complex with a carboxylate inhibitor related to rxp470
PDB DOI: 10.2210/pdb5cxa/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2015-07-28 Deposition Author(s): Devel, L. , Dive, V. , Rouanet-Mehouas, C. , Stura, E.A.
Crystal structure of the catalytic domain of human mmp12 in complex with a carboxylate inhibitor related to rxp470
Devel, L. , Dive, V. , Rouanet-Mehouas, C. , Stura, E.A.
Primary Citation of Related Structures: 5CXA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Macrophage metalloelastase | A | 159 | Homo Sapiens | MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYAYVDINTFRLSADDIRGIQSLYG |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-07-28 Deposition Author(s): Devel, L. , Dive, V. , Rouanet-Mehouas, C. , Stura, E.A.