Crystal structure of chaetomium thermophilum nup57
PDB DOI: 10.2210/pdb5cwt/pdb
Classification: TRANSPORT PROTEIN Organism(s): Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719)
Deposited: 2015-07-28 Deposition Author(s): Bley, C.J. , Hoelz, A.
Crystal structure of chaetomium thermophilum nup57
Primary Citation of Related Structures: 5CWT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nucleoporin NUP57 | A | 54 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | SDQINQAGITESDGLGEEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEKQ |
Nucleoporin NUP57 | B | 54 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | SDQINQAGITESDGLGEEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEKQ |
Nucleoporin NUP57 | C | 54 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | SDQINQAGITESDGLGEEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEKQ |
Nucleoporin NUP57 | D | 54 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | SDQINQAGITESDGLGEEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-07-28 Deposition Author(s): Bley, C.J. , Hoelz, A.