Structural and biophysical characterization of a covalent insulin dimer formed during storage of neutral formulation of human insulin
PDB DOI: 10.2210/pdb5bts/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2015-06-03 Deposition Author(s): Hjorth, C.F. , Norrman, M.
Structural and biophysical characterization of a covalent insulin dimer formed during storage of neutral formulation of human insulin
Primary Citation of Related Structures: 5BTS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-06-03 Deposition Author(s): Hjorth, C.F. , Norrman, M.