Structural and biophysical characterization of a covalent insulin dimer formed during storage of neutral formulation of human insulin
PDB DOI: 10.2210/pdb5bts/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2015-06-03 Deposition Author(s): Hjorth, C.F. , Norrman, M.
Structural and biophysical characterization of a covalent insulin dimer formed during storage of neutral formulation of human insulin
Primary Citation of Related Structures: 5BTS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-06-03 Deposition Author(s): Hjorth, C.F. , Norrman, M.