The splicing activity and an alternative domain-swapped structure of the pyrococcus horikoshii polii mini-intein
PDB DOI: 10.2210/pdb5bkh/pdb
Classification: HYDROLASE Organism(s): Pyrococcus Horikoshii (Strain Atcc 700860 / Dsm 12428 / Jcm 9974 / Nbrc 100139 / Ot-3)
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA polymerase II large subunit | A | 186 | Pyrococcus Horikoshii (Strain Atcc 700860 / Dsm 12428 / Jcm 9974 / Nbrc 100139 / Ot-3) | MHAAKRRNCFPGDTRILVQINGTPQRVTLKELYELFDEEHYESMVYVRKKPKVDIKVYSFNPEEGKVVLTDIEEVIKAPATDHLIRFELELGSSFETTVDHPVLVYENGKFVEKRAFEVREGNIIIIIDESTLEPLKVAVKKIEFIEPPEDFVFSLNAKKYHTVIINENIVTHQCDGDEDHHHHHH |
Method: X-RAY DIFFRACTION