Third ww domain from the e3 ubiquitin-protein ligase nedd4
PDB DOI: 10.2210/pdb5aht/pdb
Classification: ISOMERASE Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell)
Deposited: 2015-02-09 Deposition Author(s): Dingley, A. , Lecher, J. , Panwalkar, V.
Method: SOLUTION NMR Resolution: N.A.
Third ww domain from the e3 ubiquitin-protein ligase nedd4
Dingley, A. , Lecher, J. , Panwalkar, V.
Primary Citation of Related Structures: 5AHT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 UBIQUITIN-PROTEIN LIGASE NEDD4 | A | 43 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) | GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA |
Method: SOLUTION NMR
Deposited Date: 2015-02-09 Deposition Author(s): Dingley, A. , Lecher, J. , Panwalkar, V.