Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119l variant
PDB DOI: 10.2210/pdb4zyh/pdb
Classification: TRANSFERASE Organism(s): Sulfolobus Solfataricus
Deposited: 2015-05-21 Deposition Author(s): Miggiano, R. , Rizzi, M. , Rossi, F.
Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119l variant
Miggiano, R. , Rizzi, M. , Rossi, F.
Primary Citation of Related Structures: 4ZYH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methylated-DNA--protein-cysteine methyltransferase | A | 151 | Sulfolobus Solfataricus | MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPLHRVIAENGIGGYSRGVKLKRALLELEGVKIPE |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-05-21 Deposition Author(s): Miggiano, R. , Rizzi, M. , Rossi, F.