Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase
PDB DOI: 10.2210/pdb4zye/pdb
Classification: TRANSFERASE Organism(s): Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2)
Deposited: 2015-05-21 Deposition Author(s): Miggiano, R. , Rizzi, M. , Rossi, F.
Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase
Miggiano, R. , Rizzi, M. , Rossi, F.
Primary Citation of Related Structures: 4ZYE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methylated-DNA--protein-cysteine methyltransferase | A | 164 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) | MRGSHHHHHHTDPMLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-05-21 Deposition Author(s): Miggiano, R. , Rizzi, M. , Rossi, F.