Sh3-iii of drosophila rim-binding protein bound to a cacophony derived peptide
PDB DOI: 10.2210/pdb4z8a/pdb
Classification: rim-binding protein Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2015-04-08 Deposition Author(s): Boehme, A.M. , Driller, J.H. , Holton, N. , Loll, B. , Siebert, M. , Sigrist, S.J. , Wahl, M.C.
Method: X-RAY DIFFRACTION Resolution: 1.759 Å
Sh3-iii of drosophila rim-binding protein bound to a cacophony derived peptide
Boehme, A.M. , Driller, J.H. , Holton, N. , Loll, B. , Siebert, M. , Sigrist, S.J. , Wahl, M.C.
Primary Citation of Related Structures: 4Z8A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RIM-binding protein, isoform F | A | 75 | Drosophila Melanogaster , Synthetic Construct | GPLGSPEFNRPVKRMIALYDYDPQELSPNVDAEQVELCFKTGEIILVYGDMDEDGFYMGELDGVRGLVPSNFLAD |
| Voltage-dependent calcium channel type A subunit alpha-1 | B | 17 | Drosophila Melanogaster , Synthetic Construct | XIGRRLPPTPSKPSTLX |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-08 Deposition Author(s): Boehme, A.M. , Driller, J.H. , Holton, N. , Loll, B. , Siebert, M. , Sigrist, S.J. , Wahl, M.C.