X-ray structure of racemic shk q16k toxin
PDB DOI: 10.2210/pdb4z7p/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2015-04-07 Deposition Author(s): Sickmier, E.A.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
X-ray structure of racemic shk q16k toxin
Primary Citation of Related Structures: 4Z7P
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel toxin kappa-stichotoxin-She1a | A | 35 | N.A. | RSCIDTIPKSRCTAFKCKHSMKYRLSFCRKTCGTC |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-07 Deposition Author(s): Sickmier, E.A.