Crystal structure of brd9 bromodomain in complex with a substituted valerolactam quinolone ligand
PDB DOI: 10.2210/pdb4z6i/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2015-04-05 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Brennan, P.E. , Clark, P.G.K. , Dixon, D.J. , Edwards, A.M. , Fedorov, O. , Knapp, S. , Krojer, T. , Newman, J.A. , Nunez-Alonso, G. , Picaud, S. , Structural Genomics Consortium (Sgc) , Tallant, C. , Vieira, L.C.C. , Von Delft, F.
Crystal structure of brd9 bromodomain in complex with a substituted valerolactam quinolone ligand
Arrowsmith, C.H. , Bountra, C. , Brennan, P.E. , Clark, P.G.K. , Dixon, D.J. , Edwards, A.M. , Fedorov, O. , Knapp, S. , Krojer, T. , Newman, J.A. , Nunez-Alonso, G. , Picaud, S. , Structural Genomics Consortium (Sgc) , Tallant, C. , Vieira, L.C.C. , Von Delft, F.
Primary Citation of Related Structures: 4Z6I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 9 | A | 123 | Homo Sapiens | SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS |
| Bromodomain-containing protein 9 | B | 123 | Homo Sapiens | SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-04-05 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Brennan, P.E. , Clark, P.G.K. , Dixon, D.J. , Edwards, A.M. , Fedorov, O. , Knapp, S. , Krojer, T. , Newman, J.A. , Nunez-Alonso, G. , Picaud, S. , Structural Genomics Consortium (Sgc) , Tallant, C. , Vieira, L.C.C. , Von Delft, F.