Crystal structure of brd9 bromodomain bound to dmso
PDB DOI: 10.2210/pdb4yy4/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2015-03-23 Deposition Author(s): Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.
Method: X-RAY DIFFRACTION Resolution: 1.47 Å
Crystal structure of brd9 bromodomain bound to dmso
Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.
Primary Citation of Related Structures: 4YY4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 9 | A | 108 | Homo Sapiens | GSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-23 Deposition Author(s): Bellon, S. , Cochran, A.G. , Poy, F. , Tang, Y.