Crystal structure of truncated cerebral cavernous malformation 2 c-terminal adaptor domain in complex with an internal helix of mitogen-activated protein kinase kinase kinase 3
PDB DOI: 10.2210/pdb4yl6/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-03-05 Deposition Author(s): Ding, J. , Wang, D.C. , Wang, X.
Crystal structure of truncated cerebral cavernous malformation 2 c-terminal adaptor domain in complex with an internal helix of mitogen-activated protein kinase kinase kinase 3
Ding, J. , Wang, D.C. , Wang, X.
Primary Citation of Related Structures: 4YL6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Malcavernin | A | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDLEHHHHHH |
Mitogen-activated protein kinase kinase kinase 3 | B | 22 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDEQEALNSIMNDLVALQMNRR |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-03-05 Deposition Author(s): Ding, J. , Wang, D.C. , Wang, X.