Crystal structure of the r111k:y134f:t54v:r132q:p39q:r59y mutant of human cellular retinoic acid binding proteinii in complex with retinal after 24 h incubation and 1 hour uv irradiation at 1.92 angstrom - 1st cycle
PDB DOI: 10.2210/pdb4ybu/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2015-02-19 Deposition Author(s): Geiger, J.H. , Nosrati, M.
Crystal structure of the r111k:y134f:t54v:r132q:p39q:r59y mutant of human cellular retinoic acid binding proteinii in complex with retinal after 24 h incubation and 1 hour uv irradiation at 1.92 angstrom - 1st cycle
Primary Citation of Related Structures: 4YBU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cellular retinoic acid-binding protein 2 | A | 137 | Homo Sapiens | PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKQAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-02-19 Deposition Author(s): Geiger, J.H. , Nosrati, M.