Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1
PDB DOI: 10.2210/pdb4y6n/pdb
Classification: TRANSFERASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2015-02-13 Deposition Author(s): Albesa-Jove, D. , Cifuente, J.O. , Comino, N. , Guerin, M.E. , Rodrigo-Unzueta, A. , Sancho-Vaello, E. , Urresti, S.
Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1
Albesa-Jove, D. , Cifuente, J.O. , Comino, N. , Guerin, M.E. , Rodrigo-Unzueta, A. , Sancho-Vaello, E. , Urresti, S.
Primary Citation of Related Structures: 4Y6N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glucosyl-3-phosphoglycerate synthase | A | 328 | Mycobacterium Tuberculosis | GSGAMTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDDSDYTRHTWPVSLVDRPPMKVMRPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-02-13 Deposition Author(s): Albesa-Jove, D. , Cifuente, J.O. , Comino, N. , Guerin, M.E. , Rodrigo-Unzueta, A. , Sancho-Vaello, E. , Urresti, S.