Synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd32 ([1-(biphenyl-3-yl)-5-hydroxy-4-oxo-1,4-dihydropyridin-3-yl]boronic acid)
PDB DOI: 10.2210/pdb4xud/pdb
Classification: transferase/transferase inhibitor Organism(s): Homo Sapiens
Deposited: 2015-01-25 Deposition Author(s): Allison, T. , Sanders, J.M. , Soisson, S.M. , Wolkenberg, S.
Synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd32 ([1-(biphenyl-3-yl)-5-hydroxy-4-oxo-1,4-dihydropyridin-3-yl]boronic acid)
Allison, T. , Sanders, J.M. , Soisson, S.M. , Wolkenberg, S.
Primary Citation of Related Structures: 4XUD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Catechol O-methyltransferase | A | 218 | Homo Sapiens | NLLAGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-25 Deposition Author(s): Allison, T. , Sanders, J.M. , Soisson, S.M. , Wolkenberg, S.