Crystal structure of the mrh domain of glucosidase ii beta bound to mannose
PDB DOI: 10.2210/pdb4xqm/pdb
Classification: HYDROLASE Organism(s): Schizosaccharomyces Pombe (Strain 972 / Atcc 24843)
Deposited: 2015-01-19 Deposition Author(s): Dahms, N.M. , Kim, J.-J.P. , Olson, L.J.
Crystal structure of the mrh domain of glucosidase ii beta bound to mannose
Dahms, N.M. , Kim, J.-J.P. , Olson, L.J.
Primary Citation of Related Structures: 4XQM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glucosidase 2 subunit beta | A | 94 | Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) | YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCWNGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-19 Deposition Author(s): Dahms, N.M. , Kim, J.-J.P. , Olson, L.J.