The crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a
PDB DOI: 10.2210/pdb4xpl/pdb
Classification: TRANSFERASE Organism(s): Campylobacter Jejuni Subsp. Jejuni Pt14
Deposited: 2015-01-17 Deposition Author(s): Nam, M.S. , Namgung, B. , Song, W.S. , Yoon, S.I.
The crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a
Nam, M.S. , Namgung, B. , Song, W.S. , Yoon, S.I.
Primary Citation of Related Structures: 4XPL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| N-Acetyltransferase, PseH | A | 163 | Campylobacter Jejuni Subsp. Jejuni Pt14 | GSAKDPLIKLKNFTELNSQEIELIFKWRNHPDINQFMKTKYIDFEEHLRFLKKLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQSNCKALPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-17 Deposition Author(s): Nam, M.S. , Namgung, B. , Song, W.S. , Yoon, S.I.