Crystal structure of the sensory domain of the campylobacter jejuni chemoreceptor tlp3 (ccml) with isoleucine bound.
PDB DOI: 10.2210/pdb4xmr/pdb
Classification: SIGNALING PROTEIN Organism(s): Campylobacter Jejuni Subsp. Jejuni Serotype O:2 (Strain Nctc 11168)
Deposited: 2015-01-15 Deposition Author(s): Liu, Y.C. , Machuca, M.A. , Roujeinikova, A.
Crystal structure of the sensory domain of the campylobacter jejuni chemoreceptor tlp3 (ccml) with isoleucine bound.
Liu, Y.C. , Machuca, M.A. , Roujeinikova, A.
Primary Citation of Related Structures: 4XMR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative methyl-accepting chemotaxis signal transduction protein | A | 254 | Campylobacter Jejuni Subsp. Jejuni Serotype O:2 (Strain Nctc 11168) | GIDPFTKTSLYESTLKNQTDLLKVTQSTVEDFRSTNQSFTRALEKDIANLPYQSLITEENIINNVGPILKYYRHSINALNVYLGLNNGKVLLSQKSNDAKMPELRDDLDIKTKDWYQEALKTNDIFVTPAYLDTVLKQYVITYSKAIYKDGKIIGVLGVDIPSEDLQNLVAKTPGNTFLFDQKNKIFAATNKELLNPSIDHSPVLNAYKLNGDNNFFSYKLNNEERLGACTKVFAYTACITESADIINKPIYKA |
| Putative methyl-accepting chemotaxis signal transduction protein | B | 254 | Campylobacter Jejuni Subsp. Jejuni Serotype O:2 (Strain Nctc 11168) | GIDPFTKTSLYESTLKNQTDLLKVTQSTVEDFRSTNQSFTRALEKDIANLPYQSLITEENIINNVGPILKYYRHSINALNVYLGLNNGKVLLSQKSNDAKMPELRDDLDIKTKDWYQEALKTNDIFVTPAYLDTVLKQYVITYSKAIYKDGKIIGVLGVDIPSEDLQNLVAKTPGNTFLFDQKNKIFAATNKELLNPSIDHSPVLNAYKLNGDNNFFSYKLNNEERLGACTKVFAYTACITESADIINKPIYKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-01-15 Deposition Author(s): Liu, Y.C. , Machuca, M.A. , Roujeinikova, A.