4XC2
Crystal structure of gabarap in complex with kbtbd6 lir peptide
PDB DOI: 10.2210/pdb4xc2/pdb
Classification: IMMUNE SYSTEM Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-12-17 Deposition Author(s): Akutsu, M. , Baschieri, F. , Behrends, C. , Doetsch, V. , Farhan, H. , Genau, H.M. , Huber, J. , Rogov, V.V.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of gabarap in complex with kbtbd6 lir peptide
Akutsu, M. , Baschieri, F. , Behrends, C. , Doetsch, V. , Farhan, H. , Genau, H.M. , Huber, J. , Rogov, V.V.
Primary Citation of Related Structures: 4XC2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GABA(A) receptor-associated protein | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG |
| GABA(A) receptor-associated protein | B | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG |
| GABA(A) receptor-associated protein | C | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG |
| GABA(A) receptor-associated protein | D | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AMGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG |
| Kelch repeat and BTB domain-containing protein 6 | E | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDDDFWVRVAP |
| Kelch repeat and BTB domain-containing protein 6 | F | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDDDFWVRVAP |
| Kelch repeat and BTB domain-containing protein 6 | G | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDDDFWVRVAP |
| Kelch repeat and BTB domain-containing protein 6 | H | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDDDFWVRVAP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-17 Deposition Author(s): Akutsu, M. , Baschieri, F. , Behrends, C. , Doetsch, V. , Farhan, H. , Genau, H.M. , Huber, J. , Rogov, V.V.