Crystal structure of chromobox homology 7 (cbx7) with setdb1-1170me3 peptide
PDB DOI: 10.2210/pdb4x3s/pdb
Classification: TRANSCRIPTION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2014-12-01 Deposition Author(s): Plotnikov, A.N. , Ren, C. , Zhou, M.M.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of chromobox homology 7 (cbx7) with setdb1-1170me3 peptide
Plotnikov, A.N. , Ren, C. , Zhou, M.M.
Primary Citation of Related Structures: 4X3S
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromobox protein homolog 7 | A | 64 | Mus Musculus , Synthetic Construct | GSHMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA |
Chromobox protein homolog 7 | B | 64 | Mus Musculus , Synthetic Construct | GSHMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA |
SETDB1-1170me3 Peptide | C | 10 | Mus Musculus , Synthetic Construct | RGFALKSTHG |
SETDB1-1170me3 Peptide | D | 10 | Mus Musculus , Synthetic Construct | RGFALKSTHG |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-01 Deposition Author(s): Plotnikov, A.N. , Ren, C. , Zhou, M.M.