Crystal structure of chromobox homolog 7 (cbx7) chromodomain with h3k27me3 peptide
PDB DOI: 10.2210/pdb4x3k/pdb
Classification: TRANSCRIPTION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2014-12-01 Deposition Author(s): Ren, C. , Zhou, M.M.
Crystal structure of chromobox homolog 7 (cbx7) chromodomain with h3k27me3 peptide
Primary Citation of Related Structures: 4X3K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 7 | A | 64 | Mus Musculus , Synthetic Construct | GSHMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA |
| Chromobox protein homolog 7 | B | 64 | Mus Musculus , Synthetic Construct | GSHMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA |
| H3K27me3 peptide | C | 7 | Mus Musculus , Synthetic Construct | KAARKSA |
| H3K27me3 peptide | D | 7 | Mus Musculus , Synthetic Construct | KAARKSA |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-01 Deposition Author(s): Ren, C. , Zhou, M.M.