Crystal structure of arc n-lobe complexed with stargazin peptide
PDB DOI: 10.2210/pdb4x3h/pdb
Classification: SIGNALING PROTEIN Organism(s): Enterobacter Aerogenes , Pandinus Imperator
Deposited: 2014-11-30 Deposition Author(s): Leahy, D. , Ward, M. , Worley, P. , Zhang, W.
Crystal structure of arc n-lobe complexed with stargazin peptide
Leahy, D. , Ward, M. , Worley, P. , Zhang, W.
Primary Citation of Related Structures: 4X3H
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Activity-regulated cytoskeleton-associated protein | A | 79 | Enterobacter Aerogenes , Pandinus Imperator | GPLGSPEFPGLDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEG |
VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA-2 SUBUNIT | B | 9 | Enterobacter Aerogenes , Pandinus Imperator | RIPSYRYRY |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-30 Deposition Author(s): Leahy, D. , Ward, M. , Worley, P. , Zhang, W.