Crystal structure of bepc protein (virb-translocated bartonella effector protein) with bound amppnp from bartonella tribocorum
PDB DOI: 10.2210/pdb4wgj/pdb
Classification: TRANSFERASE Organism(s): Bartonella Tribocorum
Deposited: 2014-09-18 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of bepc protein (virb-translocated bartonella effector protein) with bound amppnp from bartonella tribocorum
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 4WGJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BepC protein | A | 227 | Bartonella Tribocorum | MAHHHHHHMEQNYLYKGTTTLKNKYGIKDPNKLYERCNHDVVKEAVNFRHEPPPQNFDAAYLSLIHWSLFHKTFEWAGHTRDTSFTFEDGTTARMPAMRPKGYEAPFAIGPQIKKELKQLEKTLNQKNNLKGLSHQEFAENAADVFMALEHAHPFRKGNGRANRMFMEKLGQAAGHTVDFSFITKGRMTTACIEAMQYGNSQPMKDLFEDITHPQKSVILKEFISQM |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-09-18 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)