4RTZ
Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12
PDB DOI: 10.2210/pdb4rtz/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 0.979 Å
Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4RTZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
| VSL12 peptide | B | 12 | Gallus Gallus , Synthetic Construct | VSLARRPLPPLP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.