PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

4RTZ

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12

PDB DOI: 10.2210/pdb4rtz/pdb

Classification: PROTEIN BINDING
Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2014-11-16
Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 0.979 Å

Literature

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12

Bacarizo, J. , Camara-Artigas, A.

Primary Citation of Related Structures: 4RTZ


Proteins
Molecule Chains Sequence Length Organism Sequence
Proto-oncogene tyrosine-protein kinase Src A 61 Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
VSL12 peptide B 12 Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) VSLARRPLPPLP
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2014-11-16
Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.