K121m mutant of n-terminal editing domain of threonyl-trna synthetase from pyrococcus abyssi with l-thr3aa
PDB DOI: 10.2210/pdb4rrr/pdb
Classification: LIGASE Organism(s): Pyrococcus Abyssi Ge5
Deposited: 2014-11-06 Deposition Author(s): Hussain, T. , Kamarthapu, V. , Sankaranarayanan, R.
K121m mutant of n-terminal editing domain of threonyl-trna synthetase from pyrococcus abyssi with l-thr3aa
Hussain, T. , Kamarthapu, V. , Sankaranarayanan, R.
Primary Citation of Related Structures: 4RRR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Threonine--tRNA ligase | A | 147 | Pyrococcus Abyssi Ge5 | MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLVAFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYPFAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYYMAFKISCKGHPLAELSRTIVPEEARVE |
| Threonine--tRNA ligase | B | 147 | Pyrococcus Abyssi Ge5 | MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLVAFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYPFAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYYMAFKISCKGHPLAELSRTIVPEEARVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-06 Deposition Author(s): Hussain, T. , Kamarthapu, V. , Sankaranarayanan, R.