Zinc-substituted pseudoazurin solved by s/zn-sad phasing
PDB DOI: 10.2210/pdb4rh4/pdb
Classification: METAL BINDING PROTEIN Organism(s): Alcaligenes Faecalis
Deposited: 2014-10-01 Deposition Author(s): Gessmann, R. , Petratos, K.
Zinc-substituted pseudoazurin solved by s/zn-sad phasing
Primary Citation of Related Structures: 4RH4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pseudoazurin | A | 123 | Alcaligenes Faecalis | ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-10-01 Deposition Author(s): Gessmann, R. , Petratos, K.