Wilms tumor protein (wt1) zinc fingers in complex with carboxylated dna
PDB DOI: 10.2210/pdb4r2r/pdb
Classification: DNA Binding Protein/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-08-12 Deposition Author(s): Cheng, X. , Hashimoto, H. , Olanrewaju, Y.O. , Wilson, G.G. , Zhang, X. , Zheng, Y.
Method: X-RAY DIFFRACTION Resolution: 2.089 Å
Wilms tumor protein (wt1) zinc fingers in complex with carboxylated dna
Cheng, X. , Hashimoto, H. , Olanrewaju, Y.O. , Wilson, G.G. , Zhang, X. , Zheng, Y.
Primary Citation of Related Structures: 4R2R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Wilms tumor protein, isoform 4/CRA_a | A | 93 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-08-12 Deposition Author(s): Cheng, X. , Hashimoto, H. , Olanrewaju, Y.O. , Wilson, G.G. , Zhang, X. , Zheng, Y.