Egr1/zif268 zinc fingers in complex with formylated dna
PDB DOI: 10.2210/pdb4r2d/pdb
Classification: DNA Binding Protein/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-08-11 Deposition Author(s): Cheng, X. , Hashimoto, H. , Olanrewaju, Y.O. , Wilson, G.G. , Zhang, X. , Zheng, Y.
Egr1/zif268 zinc fingers in complex with formylated dna
Cheng, X. , Hashimoto, H. , Olanrewaju, Y.O. , Wilson, G.G. , Zhang, X. , Zheng, Y.
Primary Citation of Related Structures: 4R2D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Early growth response protein 1 | A | 94 | Homo Sapiens , Synthetic Construct | GPLGSERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKD |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-08-11 Deposition Author(s): Cheng, X. , Hashimoto, H. , Olanrewaju, Y.O. , Wilson, G.G. , Zhang, X. , Zheng, Y.