4QY8
Crystal structure of anti-msp2 fv fragment (mab6d8) in complex with 3d7-msp2 14-30
PDB DOI: 10.2210/pdb4qy8/pdb
Classification: IMMUNE SYSTEM Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-07-24 Deposition Author(s): Anders, R.F. , Bankala, K. , Christ, D. , Drinkwater, N. , Macraild, C.A. , Mcgowan, S. , Morales, R.A.V. , Norton, R.S. , Rouet, R. , Seow, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.353 Å
Crystal structure of anti-msp2 fv fragment (mab6d8) in complex with 3d7-msp2 14-30
Anders, R.F. , Bankala, K. , Christ, D. , Drinkwater, N. , Macraild, C.A. , Mcgowan, S. , Morales, R.A.V. , Norton, R.S. , Rouet, R. , Seow, J.
Primary Citation of Related Structures: 4QY8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fv fragment(mAb6D8) heavy chain | A | 114 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA |
| Fv fragment(mAb6D8) light chain | B | 111 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DIVLTQSPASLAVSLGQRATISCKASQSVDHDGDSYMNWFQQKPGQSPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQTNEDPYTFGGGTKLEIK |
| Merozoite surface antigen 2 | Q | 19 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XNAYNMSIRRSMAESKPSX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-07-24 Deposition Author(s): Anders, R.F. , Bankala, K. , Christ, D. , Drinkwater, N. , Macraild, C.A. , Mcgowan, S. , Morales, R.A.V. , Norton, R.S. , Rouet, R. , Seow, J.