Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
PDB DOI: 10.2210/pdb4qt7/pdb
Classification: TRANSFERASE/TRANSFERASE ACTIVATOR Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2014-07-07 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 1.55 Å
Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4QT7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
| NS5A | B | 12 | Gallus Gallus , Synthetic Construct | XAPPIPPPRRKR |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-07-07 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.