Crystal structure of human baz2a bromodomain in complex with a diacetylated histone 4 peptide (h4k16ack20ac)
PDB DOI: 10.2210/pdb4qbm/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-05-08 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Krojer, T. , Nunez-Alonso, G. , Picaud, S. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F. , Williams, E.
Crystal structure of human baz2a bromodomain in complex with a diacetylated histone 4 peptide (h4k16ack20ac)
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Krojer, T. , Nunez-Alonso, G. , Picaud, S. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F. , Williams, E.
Primary Citation of Related Structures: 4QBM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain adjacent to zinc finger domain protein 2A | A | 106 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQ |
Bromodomain adjacent to zinc finger domain protein 2A | B | 106 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQ |
histone H4 peptide with sequence Gly-Ala-Lys(ac)-Arg-His-Arg-Lys(ac)-Val-Leu | C | 9 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAKRHRKVL |
histone H4 peptide with sequence Gly-Ala-Lys(ac)-Arg-His-Arg-Lys(ac)-Val-Leu | D | 9 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAKRHRKVL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-05-08 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Krojer, T. , Nunez-Alonso, G. , Picaud, S. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F. , Williams, E.