4Q6F
Crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
PDB DOI: 10.2210/pdb4q6f/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-04-22 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Ciulli, A. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Krojer, T. , Overvoorde, L. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.91 Å
Crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
Arrowsmith, C.H. , Bountra, C. , Ciulli, A. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Krojer, T. , Overvoorde, L. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.
Primary Citation of Related Structures: 4Q6F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain adjacent to zinc finger domain protein 2A | A | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
| Bromodomain adjacent to zinc finger domain protein 2A | B | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
| Bromodomain adjacent to zinc finger domain protein 2A | C | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
| Bromodomain adjacent to zinc finger domain protein 2A | D | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
| unmodified H3K4 peptide | F | 5 | Homo Sapiens , Synthetic Construct | ARTKQ |
| unmodified H3K4 peptide | G | 5 | Homo Sapiens , Synthetic Construct | ARTKQ |
| unmodified H3K4 peptide | H | 5 | Homo Sapiens , Synthetic Construct | ARTKQ |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-04-22 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Ciulli, A. , Edwards, A.M. , Filippakopoulos, P. , Knapp, S. , Krojer, T. , Overvoorde, L. , Structural Genomics Consortium (Sgc) , Tallant, C. , Von Delft, F.