Zinc finger region of mll2 in complex with cpg dna
PDB DOI: 10.2210/pdb4pzi/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-03-31 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chao, X. , Dong, A. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J.
Zinc finger region of mll2 in complex with cpg dna
Arrowsmith, C.H. , Bountra, C. , Chao, X. , Dong, A. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J.
Primary Citation of Related Structures: 4PZI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone-lysine N-methyltransferase 2B | A | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-03-31 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chao, X. , Dong, A. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Weigelt, J.