Crystal structure of mltf from pseudomonas aeruginosa complexed with isoleucine
PDB DOI: 10.2210/pdb4oz9/pdb
Classification: LYASE Organism(s): Pseudomonas Aeruginosa
Deposited: 2014-02-14 Deposition Author(s): Reddem, E. , Thunnissen, A.M.W.H.
Crystal structure of mltf from pseudomonas aeruginosa complexed with isoleucine
Reddem, E. , Thunnissen, A.M.W.H.
Primary Citation of Related Structures: 4OZ9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Membrane-bound lytic murein transglycosylase F | A | 428 | Pseudomonas Aeruginosa | PTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-02-14 Deposition Author(s): Reddem, E. , Thunnissen, A.M.W.H.