Crystal structure of oncogenic suppression activity protein - a plasmid fertility inhibition factor, gold (i) cyanide derivative
PDB DOI: 10.2210/pdb4ovb/pdb
Classification: ANTITUMOR PROTEIN Organism(s): Shigella Flexneri
Deposited: 2014-02-21 Deposition Author(s): Arulandu, A. , Goyal, P. , Maindola, P.
Crystal structure of oncogenic suppression activity protein - a plasmid fertility inhibition factor, gold (i) cyanide derivative
Arulandu, A. , Goyal, P. , Maindola, P.
Primary Citation of Related Structures: 4OVB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein osa | A | 188 | Shigella Flexneri | MLLWRRCRAWLEIRRLDKELAQSSGLPLELPQIVPNAWNEVVWRLPVPNHPDAFMTASNAAQSDFIVYVNGLAFYRAWLALGVEDSQACPLKQDMPKDRKYPSSAAHFAVGIDSPVPLADVSPTMILGHFAVCFTDGMTRSMWLLAHEVAVFPVLSRDEASAVMLAEHVGVAAPIQVSKLREQCRKIL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-02-21 Deposition Author(s): Arulandu, A. , Goyal, P. , Maindola, P.