Ancestral steroid receptor 1 in complex with estrogen response element dna
PDB DOI: 10.2210/pdb4oln/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Fremyella Diplosiphon , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-01-24 Deposition Author(s): Murphy, M.N. , Ortlund, E.O.
Ancestral steroid receptor 1 in complex with estrogen response element dna
Primary Citation of Related Structures: 4OLN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
AncSR1 | A | 82 | Fremyella Diplosiphon , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SKPKRLCQVCGDHASGFHYGVWSCEGCKAFFKRSIQGHVDYVCPATNNCTIDKHRRKSCQACRLRKCLEVGMTKGGQRKERR |
AncSR1 | B | 82 | Fremyella Diplosiphon , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SKPKRLCQVCGDHASGFHYGVWSCEGCKAFFKRSIQGHVDYVCPATNNCTIDKHRRKSCQACRLRKCLEVGMTKGGQRKERR |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-24 Deposition Author(s): Murphy, M.N. , Ortlund, E.O.