Crystal structure of the human mst1-rassf5 sarah heterodimer
PDB DOI: 10.2210/pdb4oh8/pdb
Classification: transferase/Apoptosis Organism(s): Homo Sapiens
Deposited: 2014-01-17 Deposition Author(s): Cheong, C. , Cheong, H.-K. , Hwang, E. , Hwang, K.Y. , Jeon, Y.H. , Kim, E. , Kim, H.-Y. , Lee, W.C. , Ul Mushtaq, A. , Yeo, K.J.
Crystal structure of the human mst1-rassf5 sarah heterodimer
Cheong, C. , Cheong, H.-K. , Hwang, E. , Hwang, K.Y. , Jeon, Y.H. , Kim, E. , Kim, H.-Y. , Lee, W.C. , Ul Mushtaq, A. , Yeo, K.J.
Primary Citation of Related Structures: 4OH8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Serine/threonine-protein kinase 4 | A | 51 | Homo Sapiens | GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK |
Ras association domain-containing protein 5 | B | 55 | Homo Sapiens | GSEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-17 Deposition Author(s): Cheong, C. , Cheong, H.-K. , Hwang, E. , Hwang, K.Y. , Jeon, Y.H. , Kim, E. , Kim, H.-Y. , Lee, W.C. , Ul Mushtaq, A. , Yeo, K.J.