Crystal structure of mll cxxc domain in complex with a cpg dna
PDB DOI: 10.2210/pdb4nw3/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-12-05 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Weigelt, J.
Crystal structure of mll cxxc domain in complex with a cpg dna
Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Weigelt, J.
Primary Citation of Related Structures: 4NW3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone-lysine N-methyltransferase 2A | A | 76 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHSSGRENLYFQGKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-05 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Weigelt, J.