Crystal structure of mll cxxc domain in complex with a cpg dna
PDB DOI: 10.2210/pdb4nw3/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-12-05 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Weigelt, J.
Crystal structure of mll cxxc domain in complex with a cpg dna
Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Weigelt, J.
Primary Citation of Related Structures: 4NW3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase 2A | A | 76 | Homo Sapiens , Synthetic Construct | MHHHHHHSSGRENLYFQGKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-05 Deposition Author(s): Arrowsmith, C.H. , Bian, C. , Bountra, C. , Chao, X. , Edwards, A.M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Weigelt, J.