High-resolution structure of c domain of staphylococcal protein a at room temperature
PDB DOI: 10.2210/pdb4npe/pdb
Classification: PROTEIN BINDING Organism(s): Staphylococcus Aureus
Deposited: 2013-11-21 Deposition Author(s): Deis, L.N. , Oas, T.G. , Pemble Iv, C.W. , Richardson, D.C. , Richardson, J.S.
High-resolution structure of c domain of staphylococcal protein a at room temperature
Deis, L.N. , Oas, T.G. , Pemble Iv, C.W. , Richardson, D.C. , Richardson, J.S.
Primary Citation of Related Structures: 4NPE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein A | A | 58 | Staphylococcus Aureus | ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-21 Deposition Author(s): Deis, L.N. , Oas, T.G. , Pemble Iv, C.W. , Richardson, D.C. , Richardson, J.S.