Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
PDB DOI: 10.2210/pdb4np2/pdb
Classification: Cell adhesion/inhibitor Organism(s): Mus Musculus
Deposited: 2013-11-20 Deposition Author(s): Finzel, B. , Liu, L.K.
Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
Primary Citation of Related Structures: 4NP2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CD44 antigen | A | 150 | Mus Musculus | NQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDI |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-20 Deposition Author(s): Finzel, B. , Liu, L.K.