Crystal structure of the human anks3 sam domain l52a mutant
PDB DOI: 10.2210/pdb4nj8/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Salmonella Enterica
Deposited: 2013-11-08 Deposition Author(s): Bowie, J.U. , Cascio, D. , Leettola, C.N.
Crystal structure of the human anks3 sam domain l52a mutant
Bowie, J.U. , Cascio, D. , Leettola, C.N.
Primary Citation of Related Structures: 4NJ8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ankyrin repeat and SAM domain-containing protein 3 | A | 71 | Salmonella Enterica | SRAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITAFGPKRKMTSAIARWHSSAR |
Ankyrin repeat and SAM domain-containing protein 3 | B | 71 | Salmonella Enterica | SRAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITAFGPKRKMTSAIARWHSSAR |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-11-08 Deposition Author(s): Bowie, J.U. , Cascio, D. , Leettola, C.N.