Crystal structure of 3rd ww domain of human nedd4-1
PDB DOI: 10.2210/pdb4n7f/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2013-10-15 Deposition Author(s): Gutkind, J.S. , Hurley, J. , O'Hayre, M. , Qi, S.
Method: X-RAY DIFFRACTION Resolution: 1.102 Å
Crystal structure of 3rd ww domain of human nedd4-1
Gutkind, J.S. , Hurley, J. , O'Hayre, M. , Qi, S.
Primary Citation of Related Structures: 4N7F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 38 | Homo Sapiens | AMGSFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLK |
| E3 ubiquitin-protein ligase NEDD4 | B | 38 | Homo Sapiens | AMGSFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-10-15 Deposition Author(s): Gutkind, J.S. , Hurley, J. , O'Hayre, M. , Qi, S.