Chromodomain antagonists that target the polycomb-group methyllysine reader protein chromobox homolog 7 (cbx7)
PDB DOI: 10.2210/pdb4mn3/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-09-09 Deposition Author(s): Boulanger, M.J. , Chakravarthi, S. , Daze, K. , Dev, A. , Douglas, S. , Heller, M. , Hof, F. , Peng, F. , Quon, T. , Wulff, J.
Method: X-RAY DIFFRACTION Resolution: 1.542 Å
Chromodomain antagonists that target the polycomb-group methyllysine reader protein chromobox homolog 7 (cbx7)
Boulanger, M.J. , Chakravarthi, S. , Daze, K. , Dev, A. , Douglas, S. , Heller, M. , Hof, F. , Peng, F. , Quon, T. , Wulff, J.
Primary Citation of Related Structures: 4MN3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 7 | A | 56 | Homo Sapiens , Synthetic Construct | GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
| peptide | B | 7 | Homo Sapiens , Synthetic Construct | XFAYKSX |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-09-09 Deposition Author(s): Boulanger, M.J. , Chakravarthi, S. , Daze, K. , Dev, A. , Douglas, S. , Heller, M. , Hof, F. , Peng, F. , Quon, T. , Wulff, J.