Crystal structure of the spytag/spycatcher complex
PDB DOI: 10.2210/pdb4mli/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Thermothelomyces Thermophilus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-09-06 Deposition Author(s): Fierer, J.O. , Howarth, M. , Li, L. , Rapoport, T.A.
Crystal structure of the spytag/spycatcher complex
Fierer, J.O. , Howarth, M. , Li, L. , Rapoport, T.A.
Primary Citation of Related Structures: 4MLI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Fibronectin binding protein | A | 116 | Thermothelomyces Thermophilus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMVDTLSGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI |
Fibronectin binding protein | C | 116 | Thermothelomyces Thermophilus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMVDTLSGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHI |
SpyTag | B | 13 | Thermothelomyces Thermophilus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AHIVMVDAYKPTK |
SpyTag | D | 13 | Thermothelomyces Thermophilus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AHIVMVDAYKPTK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-09-06 Deposition Author(s): Fierer, J.O. , Howarth, M. , Li, L. , Rapoport, T.A.