Crystal structure of the pnt domain of human ets2
PDB DOI: 10.2210/pdb4mhv/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2013-08-30 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Burgess-Brown, N. , Cooper, C.D.O. , Edwards, A. , Gileadi, O. , Krojer, T. , Newman, J.A. , Shrestha, L.
Crystal structure of the pnt domain of human ets2
Arrowsmith, C.H. , Bountra, C. , Burgess-Brown, N. , Cooper, C.D.O. , Edwards, A. , Gileadi, O. , Krojer, T. , Newman, J.A. , Shrestha, L.
Primary Citation of Related Structures: 4MHV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein C-ets-2 | A | 97 | Homo Sapiens | SMKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN |
| Protein C-ets-2 | B | 97 | Homo Sapiens | SMKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-30 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Burgess-Brown, N. , Cooper, C.D.O. , Edwards, A. , Gileadi, O. , Krojer, T. , Newman, J.A. , Shrestha, L.