Crystal structure of the drosphila beta,14galactosyltransferase 7 mutant d211n complex with manganese, udp-gal and xylobiose
PDB DOI: 10.2210/pdb4m4k/pdb
Classification: TRANSFERASE Organism(s): Drosophila Melanogaster
Deposited: 2013-08-07 Deposition Author(s): Qasba, P.K. , Ramakrishnan, B.
Crystal structure of the drosphila beta,14galactosyltransferase 7 mutant d211n complex with manganese, udp-gal and xylobiose
Qasba, P.K. , Ramakrishnan, B.
Primary Citation of Related Structures: 4M4K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta-4-galactosyltransferase 7 | A | 287 | Drosophila Melanogaster | ASMTGGQQMGRGSGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLENDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCS |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-07 Deposition Author(s): Qasba, P.K. , Ramakrishnan, B.